SCOP 1.71: Domain d1ay1l1: 1ay1 L:1-107

Lineage for d1ay1l1 (1ay1 L:1-107)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88528] (19 PDB entries)

8. Domain d1ay1l1: 1ay1 L:1-107 [20242]
   Other proteins in same PDB: d1ay1h1, d1ay1h2, d1ay1l2
   part of Fab TP7 against Taq DNA polymerase

Details for d1ay1l1

PDB Entry: 1ay1, 2.2 Å

PDB Description: anti taq fab tp7

SCOP Domain Sequences for d1ay1l1:

Sequence; same for both SEQRES and ATOM records:

>d1ay1l1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.2}
diqmtqspaimsaspgekvtmtcsasssvsymywyqqkpgssprlliydstnlasgvpvr
fsgsgsgtsysltisrmeaedaatyycqqwstypltfgagtklelk

Timeline for d1ay1l1:

• d1ay1l1 first appeared (with stable ids) in SCOP 1.55
  
• d1ay1l1 appears in SCOP 1.69
  
• d1ay1l1 appears in SCOP 1.73
  
• d1ay1l1 appears in the current release, SCOPe 2.08