![]() | Class b: All beta proteins [48724] (93 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) |
![]() | Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species) |
![]() | Species Fab TP7 (mouse), kappa L chain [48850] (2 PDB entries) |
![]() | Domain d1ay1l1: 1ay1 L:1-107 [20242] Other proteins in same PDB: d1ay1h2, d1ay1l2 |
PDB Entry: 1ay1 (more details), 2.2 Å
SCOP Domain Sequences for d1ay1l1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ay1l1 b.1.1.1 (L:1-107) Immunoglobulin (variable domains of L and H chains) {Fab TP7 (mouse), kappa L chain} diqmtqspaimsaspgekvtmtcsasssvsymywyqqkpgssprlliydstnlasgvpvr fsgsgsgtsysltisrmeaedaatyycqqwstypltfgagtklelk
Timeline for d1ay1l1: