Lineage for d1a3lh1 (1a3l H:1-113)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 51642Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 51698Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)
  7. 51980Species Diels alder catalytic Fab 13G5 (mouse), kappa L chain [48849] (1 PDB entry)
  8. 51981Domain d1a3lh1: 1a3l H:1-113 [20241]
    Other proteins in same PDB: d1a3lh2, d1a3ll2

Details for d1a3lh1

PDB Entry: 1a3l (more details), 1.95 Å

PDB Description: catalysis of a disfavored reaction: an antibody exo diels-alderase-tsa-inhibitor complex at 1.95 a resolution

SCOP Domain Sequences for d1a3lh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a3lh1 b.1.1.1 (H:1-113) Immunoglobulin (variable domains of L and H chains) {Diels alder catalytic Fab 13G5 (mouse), kappa L chain}
evqleesgpelvrpgtsvkisckasgytftnywlgwvkqrpghgfewigdiypggvyttn
nekfrgkailtadtssstaymqlssltsedsavyfcaraggyytggdywgqgtsvtvss

SCOP Domain Coordinates for d1a3lh1:

Click to download the PDB-style file with coordinates for d1a3lh1.
(The format of our PDB-style files is described here.)

Timeline for d1a3lh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a3lh2