Lineage for d1a3ll2 (1a3l L:108-212)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 52912Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 53260Protein Immunoglobulin (constant domains of L and H chains) [48972] (161 species)
  7. 53452Species Diels alder catalytic Fab 13G5 (mouse), kappa L chain [49062] (1 PDB entry)
  8. 53454Domain d1a3ll2: 1a3l L:108-212 [21252]
    Other proteins in same PDB: d1a3lh1, d1a3ll1

Details for d1a3ll2

PDB Entry: 1a3l (more details), 1.95 Å

PDB Description: catalysis of a disfavored reaction: an antibody exo diels-alderase-tsa-inhibitor complex at 1.95 a resolution

SCOP Domain Sequences for d1a3ll2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a3ll2 b.1.1.2 (L:108-212) Immunoglobulin (constant domains of L and H chains) {Diels alder catalytic Fab 13G5 (mouse), kappa L chain}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
tkdstysmsstltltkdeyerhnsytceathktstspivksfnrn

SCOP Domain Coordinates for d1a3ll2:

Click to download the PDB-style file with coordinates for d1a3ll2.
(The format of our PDB-style files is described here.)

Timeline for d1a3ll2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a3ll1