SCOPe 2.08: Domain d4h4ga_: 4h4g A:

Lineage for d4h4ga_ (4h4g A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families)

5. Family d.38.1.0: automated matches [191325] (1 protein)
   not a true family

6. Protein automated matches [190143] (42 species)
   not a true protein

7. Species Burkholderia thailandensis [TaxId:271848] [193479] (1 PDB entry)

8. Domain d4h4ga_: 4h4g A: [202358]
   automated match to d4h4gi_

Details for d4h4ga_

PDB Entry: 4h4g, 2.65 Å

PDB Description: Crystal Structure of (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase from Burkholderia thailandensis E264

PDB Compounds: (A:) (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase

SCOPe Domain Sequences for d4h4ga_:

Sequence, based on SEQRES records:

>d4h4ga_ d.38.1.0 (A:) automated matches {Burkholderia thailandensis [TaxId: 271848]}
fdihkiltllphrypillvdrvlelephksikalknvtvnepfftghfpkrpvmpgvlii
ealaqaaalltfaeaepkdpentlyyfvgidnarfkrvvepgdqlilnvtferyirgiwk
fkavaevdgkvaaeaelmctvkt

Sequence, based on observed residues (ATOM records):

>d4h4ga_ d.38.1.0 (A:) automated matches {Burkholderia thailandensis [TaxId: 271848]}
fdihkiltllphrypillvdrvlelephksikalknvtvnepfftghfpkrpvmpgvlii
ealaqaaalltfaealyyfvgidnarfkrvvepgdqlilnvtferyirgiwkfkavaevd
gkvaaeaelmctvkt

Timeline for d4h4ga_:

• d4h4ga_ first appeared in SCOPe 2.03
  
• d4h4ga_ appears in SCOPe 2.07