Lineage for d4g7oo_ (4g7o O:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1506616Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily)
    core: 2 helices and adjacent loops
  4. 1506617Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families) (S)
    the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits
  5. 1506618Family a.143.1.1: RNA polymerase omega subunit [63563] (2 proteins)
    4 helices; irregular array
  6. 1506619Protein RNA polymerase omega subunit [63564] (3 species)
  7. 1506624Species Thermus thermophilus HB8 [TaxId:300852] [158241] (6 PDB entries)
  8. 1506628Domain d4g7oo_: 4g7o O: [202216]
    Other proteins in same PDB: d4g7oa1, d4g7oa2, d4g7ob1, d4g7ob2, d4g7oc_, d4g7od_, d4g7of1, d4g7of2, d4g7of3, d4g7ok1, d4g7ok2, d4g7ol1, d4g7ol2, d4g7om_, d4g7on_, d4g7op1, d4g7op2, d4g7op3
    automated match to d2o5ie_
    protein/DNA complex; protein/RNA complex; complexed with mg, zn

Details for d4g7oo_

PDB Entry: 4g7o (more details), 2.99 Å

PDB Description: Crystal structure of Thermus thermophilus transcription initiation complex containing 2 nt of RNA
PDB Compounds: (O:) DNA-directed RNA polymerase subunit omega

SCOPe Domain Sequences for d4g7oo_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4g7oo_ a.143.1.1 (O:) RNA polymerase omega subunit {Thermus thermophilus HB8 [TaxId: 300852]}
aepgidklfgmvdskyrltvvvakraqqllrhgfkntvlepeerpkmqtleglfddpnav
twamkelltgrlvfgenlvpedrlqkemerlypv

SCOPe Domain Coordinates for d4g7oo_:

Click to download the PDB-style file with coordinates for d4g7oo_.
(The format of our PDB-style files is described here.)

Timeline for d4g7oo_: