Lineage for d4fzco_ (4fzc O:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2990986Protein Proteasome beta subunit (catalytic) [56252] (7 species)
  7. 2990995Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (202 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 2992845Domain d4fzco_: 4fzc O: [202159]
    Other proteins in same PDB: d4fzcd_, d4fzcg_, d4fzck_, d4fzcr_, d4fzcu_, d4fzcy_
    automated match to d1jd2v_

Details for d4fzco_

PDB Entry: 4fzc (more details), 2.8 Å

PDB Description: 20s yeast proteasome in complex with cepafungin i
PDB Compounds: (O:) Proteasome component Y7

SCOPe Domain Sequences for d4fzco_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fzco_ d.153.1.4 (O:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mtdrysfslttfspsgklgqidyaltavkqgvtslgikatngvviatekksssplamset
lskvslltpdigavysgmgpdyrvlvdksrkvahtsykriygeypptkllvsevakimqe
atqsggvrpfgvslliaghdefngfslyqvdpsgsyfpwkataigkgsvaaktflekrwn
deleledaihialltlkesvegefngdtielaiigdenpdllgytgiptdkgprfrklts
qeindrleal

SCOPe Domain Coordinates for d4fzco_:

Click to download the PDB-style file with coordinates for d4fzco_.
(The format of our PDB-style files is described here.)

Timeline for d4fzco_: