Lineage for d4f7fb_ (4f7f B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2711837Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (2 families) (S)
    the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity
  5. 2711930Family a.39.2.0: automated matches [191595] (1 protein)
    not a true family
  6. 2711931Protein automated matches [191085] (10 species)
    not a true protein
  7. 2711932Species African malaria mosquito (Anopheles gambiae) [TaxId:7165] [193461] (7 PDB entries)
  8. 2711942Domain d4f7fb_: 4f7f B: [202018]
    automated match to d4f7fd_
    complexed with 2pe, pg6

Details for d4f7fb_

PDB Entry: 4f7f (more details), 1.8 Å

PDB Description: structure of anopheles gambiae odorant binding protein 20
PDB Compounds: (B:) agap005208-pa

SCOPe Domain Sequences for d4f7fb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4f7fb_ a.39.2.0 (B:) automated matches {African malaria mosquito (Anopheles gambiae) [TaxId: 7165]}
tveqmmksgemirsvclgktkvaeelvnglreskfadvkelkcyvncvmemmqtmkkgkl
nydasvkqidtimpdelagpmraaldicrtvadgiknncdaayvllqclsknnpkfifp

SCOPe Domain Coordinates for d4f7fb_:

Click to download the PDB-style file with coordinates for d4f7fb_.
(The format of our PDB-style files is described here.)

Timeline for d4f7fb_: