| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (2 families) ![]() the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity |
| Family a.39.2.0: automated matches [191595] (1 protein) not a true family |
| Protein automated matches [191085] (10 species) not a true protein |
| Species African malaria mosquito (Anopheles gambiae) [TaxId:7165] [193461] (7 PDB entries) |
| Domain d4f7fd_: 4f7f D: [193462] automated match to d3b6xa_ complexed with 2pe, pg6 |
PDB Entry: 4f7f (more details), 1.8 Å
SCOPe Domain Sequences for d4f7fd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4f7fd_ a.39.2.0 (D:) automated matches {African malaria mosquito (Anopheles gambiae) [TaxId: 7165]}
tveqmmksgemirsvclgktkvaeelvnglreskfadvkelkcyvncvmemmqtmkkgkl
nydasvkqidtimpdelagpmraaldicrtvadgiknncdaayvllqclsknnpkfifp
Timeline for d4f7fd_: