Lineage for d4eu2b_ (4eu2 B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224590Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2224591Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2224775Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2226421Protein Proteasome beta subunit (catalytic) [56252] (6 species)
  7. 2226430Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (174 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 2226480Domain d4eu2b_: 4eu2 B: [201960]
    Other proteins in same PDB: d4eu2a_, d4eu2c_, d4eu2d_, d4eu2e_, d4eu2f_, d4eu2g_, d4eu2i_, d4eu2j_, d4eu2o_, d4eu2s_
    automated match to d1jd2v_
    complexed with wpi

Details for d4eu2b_

PDB Entry: 4eu2 (more details), 2.51 Å

PDB Description: Crystal structure of 20s proteasome with novel inhibitor K-7174
PDB Compounds: (B:) Proteasome component Y7

SCOPe Domain Sequences for d4eu2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4eu2b_ d.153.1.4 (B:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mtdrysfslttfspsgklgqidyaltavkqgvtslgikatngvviatekksssplamset
lskvslltpdigavysgmgpdyrvlvdksrkvahtsykriygeypptkllvsevakimqe
atqsggvrpfgvslliaghdefngfslyqvdpsgsyfpwkataigkgsvaaktflekrwn
deleledaihialltlkesvegefngdtielaiigdenpdllgytgiptdkgprfrklts
qeindrlea

SCOPe Domain Coordinates for d4eu2b_:

Click to download the PDB-style file with coordinates for d4eu2b_.
(The format of our PDB-style files is described here.)

Timeline for d4eu2b_: