Lineage for d1aqkh1 (1aqk H:1-123)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 929301Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 929498Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 929678Species Human (Homo sapiens), cluster 3 [TaxId:9606] [88547] (33 PDB entries)
    Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3)
  8. 929682Domain d1aqkh1: 1aqk H:1-123 [20193]
    Other proteins in same PDB: d1aqkh2, d1aqkl1, d1aqkl2
    part of Fab B7-15A2

Details for d1aqkh1

PDB Entry: 1aqk (more details), 1.84 Å

PDB Description: three-dimensional structure of a human fab with high affinity for tetanus toxoid
PDB Compounds: (H:) fab b7-15a2

SCOPe Domain Sequences for d1aqkh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aqkh1 b.1.1.1 (H:1-123) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 3 [TaxId: 9606]}
evqlvesgggvvqpgrslrlscaasgftfnnyaihwvrqapgkglewvafisydgsknyy
adsvkgrftisrdnskntlflqmnslrpedtaiyycarvlfqqlvlyapfdiwgqgtmvt
vss

SCOPe Domain Coordinates for d1aqkh1:

Click to download the PDB-style file with coordinates for d1aqkh1.
(The format of our PDB-style files is described here.)

Timeline for d1aqkh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1aqkh2