SCOPe 2.08: Domain d4ej8b_: 4ej8 B:

Lineage for d4ej8b_ (4ej8 B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Human immunodeficiency virus type 1 protease [50632] (9 species)

7. Species Human immunodeficiency virus 1 [TaxId:11676] [224867] (58 PDB entries)

8. Domain d4ej8b_: 4ej8 B: [201849]
   automated match to d4ejlb_
   complexed with 1f1, dms, edo

Details for d4ej8b_

PDB Entry: 4ej8, 2.35 Å

PDB Description: apo hiv protease (pr) dimer in closed form with fragment 1f1 in the outside/top of flap

PDB Compounds: (B:) Protease

SCOPe Domain Sequences for d4ej8b_:

Sequence; same for both SEQRES and ATOM records:

>d4ej8b_ b.50.1.1 (B:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus 1 [TaxId: 11676]}
pqitlwkrplvtikiggqlkealldtgaddtvieemnlpgrwkpkmiggiggfikvrqyd
qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf

Timeline for d4ej8b_:

• d4ej8b_ first appeared in SCOPe 2.03
  
• d4ej8b_ appears in SCOPe 2.07