Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.4: His-Me finger endonucleases [54059] (1 superfamily) core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structures |
Superfamily d.4.1: His-Me finger endonucleases [54060] (6 families) common motif contains conserved histidine residue and metal-binding site |
Family d.4.1.2: DNA/RNA non-specific endonuclease [54066] (2 proteins) the core motif is inserted in a six-stranded meander beta-sheet domain automatically mapped to Pfam PF01223 |
Protein Sm endonuclease [54067] (1 species) |
Species Serratia marcescens [TaxId:615] [54068] (5 PDB entries) |
Domain d4e3yb_: 4e3y B: [201794] automated match to d1g8ta_ complexed with edo, gol, mg, peg, so4 |
PDB Entry: 4e3y (more details), 0.95 Å
SCOPe Domain Sequences for d4e3yb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4e3yb_ d.4.1.2 (B:) Sm endonuclease {Serratia marcescens [TaxId: 615]} sidncavgcptggssnvsivrhaytlnnnsttkfanwvayhitkdtpasgktrnwktdpa lnpadtlapadytganaalkvdrghqaplaslagvsdweslnylsnitpqksdlnqgawa rledqerklidradissvytvtgplyerdmgklpgtqkahtipsaywkvifinnspavnh yaaflfdqntpkgadfcqfrvtvdeiekrtgliiwaglpddvqaslkskpgvlpelmgck
Timeline for d4e3yb_: