Lineage for d4e3yb_ (4e3y B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1889894Fold d.4: His-Me finger endonucleases [54059] (1 superfamily)
    core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structures
  4. 1889895Superfamily d.4.1: His-Me finger endonucleases [54060] (7 families) (S)
    common motif contains conserved histidine residue and metal-binding site
  5. 1889961Family d.4.1.2: DNA/RNA non-specific endonuclease [54066] (2 proteins)
    the core motif is inserted in a six-stranded meander beta-sheet domain
    automatically mapped to Pfam PF01223
  6. 1889966Protein Sm endonuclease [54067] (1 species)
  7. 1889967Species Serratia marcescens [TaxId:615] [54068] (5 PDB entries)
  8. 1889969Domain d4e3yb_: 4e3y B: [201794]
    automated match to d1g8ta_
    complexed with edo, gol, mg, peg, so4

Details for d4e3yb_

PDB Entry: 4e3y (more details), 0.95 Å

PDB Description: X-ray structure of the Serratia marcescens endonuclease at 0.95 A resolution
PDB Compounds: (B:) Nuclease

SCOPe Domain Sequences for d4e3yb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4e3yb_ d.4.1.2 (B:) Sm endonuclease {Serratia marcescens [TaxId: 615]}
sidncavgcptggssnvsivrhaytlnnnsttkfanwvayhitkdtpasgktrnwktdpa
lnpadtlapadytganaalkvdrghqaplaslagvsdweslnylsnitpqksdlnqgawa
rledqerklidradissvytvtgplyerdmgklpgtqkahtipsaywkvifinnspavnh
yaaflfdqntpkgadfcqfrvtvdeiekrtgliiwaglpddvqaslkskpgvlpelmgck

SCOPe Domain Coordinates for d4e3yb_:

Click to download the PDB-style file with coordinates for d4e3yb_.
(The format of our PDB-style files is described here.)

Timeline for d4e3yb_: