Lineage for d4dnka_ (4dnk A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. Superfamily a.118.7: 14-3-3 protein [48445] (1 family) (S)
    automatically mapped to Pfam PF00244
  5. Family a.118.7.1: 14-3-3 protein [48446] (5 proteins)
  6. Protein automated matches [190238] (5 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [187008] (38 PDB entries)
  8. 1501415Domain d4dnka_: 4dnk A: [201721]
    automated match to d4dnkb_
    complexed with edo, po4

Details for d4dnka_

PDB Entry: 4dnk (more details), 2.2 Å

PDB Description: crystal structure of a tyrosine 3-monooxygenase/tryptophan 5- monooxygenase activation protein, beta polypeptide (ywhab) from homo sapiens at 2.20 a resolution.
PDB Compounds: (A:) 14-3-3 protein beta/alpha

SCOPe Domain Sequences for d4dnka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dnka_ a.118.7.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tmdkselvqkaklaeqaeryddmaaamkavteqghelsneernllsvayknvvgarrssw
rvissieqkternekkqqmgkeyrekieaelqdicndvlelldkylipnatqpeskvfyl
kmkgdyfrylsevasgdnkqttvsnsqqayqeafeiskkemqpthpirlglalnfsvfyy
eilnspekacslaktafdeaiaeldtlneesykdstlimqllrdnltlwtse

SCOPe Domain Coordinates for d4dnka_:

Click to download the PDB-style file with coordinates for d4dnka_.
(The format of our PDB-style files is described here.)

Timeline for d4dnka_: