Lineage for d2hrpl1 (2hrp L:1-107)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2740696Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2741155Species Mouse (Mus musculus), cluster 2 [TaxId:10090] [88526] (28 PDB entries)
  8. 2741158Domain d2hrpl1: 2hrp L:1-107 [20170]
    Other proteins in same PDB: d2hrph1, d2hrph2, d2hrpl2, d2hrpm2, d2hrpn1, d2hrpn2
    part of Fab F11.2.32 against HIV-1 protease

Details for d2hrpl1

PDB Entry: 2hrp (more details), 2.2 Å

PDB Description: antigen-antibody complex
PDB Compounds: (L:) monoclonal antibody f11.2.32

SCOPe Domain Sequences for d2hrpl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hrpl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 2 [TaxId: 10090]}
dtvltqspaslavslgqratiscrasesvdyygksfmnwfqqkpgqppklliyaasnqgs
gvparfsgsgsgtdfslhihpmeeddsamyfcqqskevpwtfgggtkleik

SCOPe Domain Coordinates for d2hrpl1:

Click to download the PDB-style file with coordinates for d2hrpl1.
(The format of our PDB-style files is described here.)

Timeline for d2hrpl1: