Lineage for d4apzn_ (4apz N:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2817864Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2818071Superfamily b.85.4: dUTPase-like [51283] (2 families) (S)
    forms tight trimer through an additional beta-sheet in each subunit
    subunit beta-sheets are orthogonally packed around the three-fold axis
  5. 2818270Family b.85.4.0: automated matches [191644] (1 protein)
    not a true family
  6. 2818271Protein automated matches [191182] (20 species)
    not a true protein
  7. 2818279Species Bacillus subtilis [TaxId:1423] [189439] (11 PDB entries)
  8. 2818336Domain d4apzn_: 4apz N: [201482]
    automated match to d4apz1_
    complexed with dur, mg, po4, pop

Details for d4apzn_

PDB Entry: 4apz (more details), 2.01 Å

PDB Description: Structure of B. subtilis genomic dUTPase YncF in complex with dU, PPi and Mg in P1
PDB Compounds: (N:) probable deoxyuridine 5'-triphosphate nucleotidohydrolase yncf

SCOPe Domain Sequences for d4apzn_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4apzn_ b.85.4.0 (N:) automated matches {Bacillus subtilis [TaxId: 1423]}
mqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahvvp
rsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmpav
elvevehlgnedrgglgstgtk

SCOPe Domain Coordinates for d4apzn_:

Click to download the PDB-style file with coordinates for d4apzn_.
(The format of our PDB-style files is described here.)

Timeline for d4apzn_: