Class b: All beta proteins [48724] (180 folds) |
Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
Superfamily b.85.4: dUTPase-like [51283] (2 families) forms tight trimer through an additional beta-sheet in each subunit subunit beta-sheets are orthogonally packed around the three-fold axis |
Family b.85.4.0: automated matches [191644] (1 protein) not a true family |
Protein automated matches [191182] (20 species) not a true protein |
Species Bacillus subtilis [TaxId:1423] [189439] (11 PDB entries) |
Domain d4apzq_: 4apz Q: [201485] automated match to d4apza_ complexed with dur, mg, po4, pop |
PDB Entry: 4apz (more details), 2.01 Å
SCOPe Domain Sequences for d4apzq_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4apzq_ b.85.4.0 (Q:) automated matches {Bacillus subtilis [TaxId: 1423]} tmqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahvv prsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmpa velvevehlgnedrgglgstgtk
Timeline for d4apzq_:
View in 3D Domains from other chains: (mouse over for more information) d4apz1_, d4apz2_, d4apz3_, d4apz4_, d4apz5_, d4apz6_, d4apz7_, d4apz8_, d4apz9_, d4apza_, d4apzb_, d4apzc_, d4apzd_, d4apze_, d4apzf_, d4apzg_, d4apzh_, d4apzi_, d4apzj_, d4apzk_, d4apzl_, d4apzm_, d4apzn_, d4apzo_, d4apzp_, d4apzr_, d4apzs_, d4apzt_, d4apzu_, d4apzv_, d4apzw_, d4apzx_, d4apzy_, d4apzz_ |