Lineage for d4a6ah_ (4a6a H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2817864Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2818071Superfamily b.85.4: dUTPase-like [51283] (2 families) (S)
    forms tight trimer through an additional beta-sheet in each subunit
    subunit beta-sheets are orthogonally packed around the three-fold axis
  5. 2818072Family b.85.4.1: dUTPase-like [51284] (5 proteins)
  6. 2818085Protein Deoxycytidine triphosphate deaminase (dCTP deaminase) [117335] (2 species)
  7. 2818121Species Mycobacterium tuberculosis [TaxId:83332] [188349] (3 PDB entries)
  8. 2818137Domain d4a6ah_: 4a6a H: [201409]
    automated match to d4a6al_
    complexed with mg, ttp
    has additional insertions and/or extensions that are not grouped together

Details for d4a6ah_

PDB Entry: 4a6a (more details), 2.9 Å

PDB Description: a115v variant of dctp deaminase-dutpase from mycobacterium tuberculosis in complex with dttp
PDB Compounds: (H:) deoxycytidine triphosphate deaminase

SCOPe Domain Sequences for d4a6ah_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4a6ah_ b.85.4.1 (H:) Deoxycytidine triphosphate deaminase (dCTP deaminase) {Mycobacterium tuberculosis [TaxId: 83332]}
mllsdrdlraeissgrlgidpfddtlvqpssidvrldclfrvfnntrythidpakqqdel
tslvqpvdgepfvlhpgefvlgstlelftlpdnlagrlegksslgrlgllthstvgfidp
gfsghitlelsnvanlpitlwpgmkigqlcmlrltspsehpygssragskyqgqrgptps
rsyqnfirs

SCOPe Domain Coordinates for d4a6ah_:

Click to download the PDB-style file with coordinates for d4a6ah_.
(The format of our PDB-style files is described here.)

Timeline for d4a6ah_: