![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
![]() | Superfamily b.85.4: dUTPase-like [51283] (2 families) ![]() forms tight trimer through an additional beta-sheet in each subunit subunit beta-sheets are orthogonally packed around the three-fold axis |
![]() | Family b.85.4.1: dUTPase-like [51284] (5 proteins) |
![]() | Protein Deoxycytidine triphosphate deaminase (dCTP deaminase) [117335] (2 species) |
![]() | Species Mycobacterium tuberculosis [TaxId:83332] [188349] (3 PDB entries) |
![]() | Domain d4a6ab_: 4a6a B: [201403] automated match to d4a6al_ complexed with mg, ttp has additional insertions and/or extensions that are not grouped together |
PDB Entry: 4a6a (more details), 2.9 Å
SCOPe Domain Sequences for d4a6ab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4a6ab_ b.85.4.1 (B:) Deoxycytidine triphosphate deaminase (dCTP deaminase) {Mycobacterium tuberculosis [TaxId: 83332]} mllsdrdlraeissgrlgidpfddtlvqpssidvrldclfrvfnntrythidpakqqdel tslvqpvdgepfvlhpgefvlgstlelftlpdnlagrlegksslgrlgllthstvgfidp gfsghitlelsnvanlpitlwpgmkigqlcmlrltspsehpygssragskyqgqrgptps rsyqnfir
Timeline for d4a6ab_: