Lineage for d3zi7b1 (3zi7 B:803-1077)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2507025Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2507026Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2507635Family c.69.1.2: Carboxylesterase [53487] (7 proteins)
  6. 2507663Protein Feruloyl esterase domain of the cellulosomal xylanase y [69579] (1 species)
  7. 2507664Species Clostridium thermocellum [TaxId:1515] [69580] (5 PDB entries)
  8. 2507671Domain d3zi7b1: 3zi7 B:803-1077 [201320]
    Other proteins in same PDB: d3zi7a1, d3zi7a2, d3zi7b2
    automated match to d1gkka_
    complexed with cd

Details for d3zi7b1

PDB Entry: 3zi7 (more details), 2.3 Å

PDB Description: structure of fae solved by sad from data collected by direct data collection (ddc) using the grob robot goniometer
PDB Compounds: (B:) endo-1,4-beta-xylanase y

SCOPe Domain Sequences for d3zi7b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zi7b1 c.69.1.2 (B:803-1077) Feruloyl esterase domain of the cellulosomal xylanase y {Clostridium thermocellum [TaxId: 1515]}
sfkyesavqyrpapdsylnpcpqagrivketytgingtkslnvylpygydpnkkynifyl
mhgggenentifsndvklqnildhaimngeleplivvtptfnggnctaqnfyqefrqnvi
pfveskystyaesttpqgiaasrmhrgfggfsmgglttwyvmvncldyvayfmplsgdyw
ygnspqdkansiaeainrsglskreyfvfaatgsediayanmnpqieamkalphfdytsd
fskgnfyflvapgathwwgyvrhyiydalpyffhe

SCOPe Domain Coordinates for d3zi7b1:

Click to download the PDB-style file with coordinates for d3zi7b1.
(The format of our PDB-style files is described here.)

Timeline for d3zi7b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3zi7b2