Lineage for d3w5ug1 (3w5u G:19-154)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1543994Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 1544418Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) (S)
  5. 1544597Family b.43.4.0: automated matches [227162] (1 protein)
    not a true family
  6. 1544598Protein automated matches [226870] (16 species)
    not a true protein
  7. 1544648Species Maize (Zea mays) [TaxId:4577] [226539] (5 PDB entries)
  8. 1544657Domain d3w5ug1: 3w5u G:19-154 [201280]
    Other proteins in same PDB: d3w5ua2, d3w5ub_, d3w5uc2, d3w5ud_, d3w5ue2, d3w5uf_, d3w5ug2, d3w5uh_
    automated match to d1frna1
    complexed with fad, fes

Details for d3w5ug1

PDB Entry: 3w5u (more details), 2.7 Å

PDB Description: Cross-linked complex between Ferredoxin and Ferredoxin-NADP+ reductase
PDB Compounds: (G:) ferredoxin

SCOPe Domain Sequences for d3w5ug1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3w5ug1 b.43.4.0 (G:19-154) automated matches {Maize (Zea mays) [TaxId: 4577]}
cskkqeegvvtnlykpkepyvgrcllntkitgddapgetwhmvfstegkipyregqsigv
iadgvdkngkphkvrlysiassaigdfgdsktvslcvkrliytndageivkgvcsnflcd
lqpgdnvqitgpvgke

SCOPe Domain Coordinates for d3w5ug1:

Click to download the PDB-style file with coordinates for d3w5ug1.
(The format of our PDB-style files is described here.)

Timeline for d3w5ug1: