Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) |
Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins) |
Protein 2Fe-2S ferredoxin [54294] (17 species) |
Species Maize (Zea mays) [TaxId:4577] [54305] (3 PDB entries) |
Domain d3w5uf_: 3w5u F: [201279] Other proteins in same PDB: d3w5ua1, d3w5ua2, d3w5uc1, d3w5uc2, d3w5ue1, d3w5ue2, d3w5ug1, d3w5ug2 automated match to d3w5ub_ complexed with fad, fes |
PDB Entry: 3w5u (more details), 2.7 Å
SCOPe Domain Sequences for d3w5uf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3w5uf_ d.15.4.1 (F:) 2Fe-2S ferredoxin {Maize (Zea mays) [TaxId: 4577]} atynvklitpegevelqvpddvyildqaeedgidlpyscragscsscagkvvsgsvdqcd qsylddgqiadgwvltchayptsdvviethkeee
Timeline for d3w5uf_: