SCOPe 2.05: Domain d3vzjb_: 3vzj B:

Lineage for d3vzjb_ (3vzj B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)

6. Protein Xylanase II [49979] (19 species)
   Partial overlap with common fold and the active sites of the other endoglucanases

7. Species Bacillus circulans [TaxId:1397] [49980] (21 PDB entries)

8. Domain d3vzjb_: 3vzj B: [201259]
   automated match to d3vzja_
   complexed with so4; mutant

Details for d3vzjb_

PDB Entry: 3vzj, 2.41 Å

PDB Description: Crystal structure of the Bacillus circulans endo-beta-(1,4)-xylanase (BcX) E172H mutant

PDB Compounds: (B:) endo-1,4-beta-xylanase

SCOPe Domain Sequences for d3vzjb_:

Sequence; same for both SEQRES and ATOM records:

>d3vzjb_ b.29.1.11 (B:) Xylanase II {Bacillus circulans [TaxId: 1397]}
astdywqnwtdgggivnavngsggnysvnwsntgnfvvgkgwttgspfrtinynagvwap
ngngyltlygwtrsplieyyvvdswgtyrptgtykgtvksdggtydiytttrynapsidg
drttftqywsvrqskrptgsnatitftnhvnawkshgmnlgsnwayqvmathgyqssgss
nvtvw

Timeline for d3vzjb_:

• d3vzjb_ first appeared in SCOPe 2.03
  
• d3vzjb_ appears in SCOPe 2.04
  
• d3vzjb_ appears in SCOPe 2.06
  
• d3vzjb_ appears in the current release, SCOPe 2.08