Lineage for d3vttb_ (3vtt B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2766140Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2766141Protein automated matches [190226] (81 species)
    not a true protein
  7. 2766231Species Dengue virus type 3 [TaxId:408870] [193303] (1 PDB entry)
  8. 2766233Domain d3vttb_: 3vtt B: [201256]
    automated match to d3vtta_
    complexed with so4

Details for d3vttb_

PDB Entry: 3vtt (more details), 1.7 Å

PDB Description: High Resolution crystal structure of Dengue 3 Envelope protein domain III (ED3)
PDB Compounds: (B:) Envelope protein E

SCOPe Domain Sequences for d3vttb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vttb_ b.1.18.0 (B:) automated matches {Dengue virus type 3 [TaxId: 408870]}
msyamclntfvlkkevsetqhgtilikveykgedapckipfstedgqgkahngrlitanp
vvtkkeepvnieaeppfgesnivigigdkalkinwyrkgssigk

SCOPe Domain Coordinates for d3vttb_:

Click to download the PDB-style file with coordinates for d3vttb_.
(The format of our PDB-style files is described here.)

Timeline for d3vttb_: