![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
![]() | Protein automated matches [190226] (81 species) not a true protein |
![]() | Species Dengue virus type 3 [TaxId:408870] [193303] (1 PDB entry) |
![]() | Domain d3vttb_: 3vtt B: [201256] automated match to d3vtta_ complexed with so4 |
PDB Entry: 3vtt (more details), 1.7 Å
SCOPe Domain Sequences for d3vttb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vttb_ b.1.18.0 (B:) automated matches {Dengue virus type 3 [TaxId: 408870]} msyamclntfvlkkevsetqhgtilikveykgedapckipfstedgqgkahngrlitanp vvtkkeepvnieaeppfgesnivigigdkalkinwyrkgssigk
Timeline for d3vttb_: