SCOPe 2.03: Domain d3ukua1: 3uku A:2-160

Lineage for d3ukua1 (3uku A:2-160)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)

6. Protein Actin-related protein 3, Arp3 [69528] (1 species)
   part of Arp2/3 complex

7. Species Cow (Bos taurus) [TaxId:9913] [69529] (16 PDB entries)
   Uniprot P61158

8. Domain d3ukua1: 3uku A:2-160 [200998]
   Other proteins in same PDB: d3ukub_, d3ukuc_, d3ukud1, d3ukud2, d3ukue_, d3ukuf_, d3ukug_
   automated match to d1u2va1
   complexed with c69

Details for d3ukua1

PDB Entry: 3uku, 2.75 Å

PDB Description: Structure of Arp2/3 complex with bound inhibitor CK-869

PDB Compounds: (A:) actin-like protein 3

SCOPe Domain Sequences for d3ukua1:

Sequence, based on SEQRES records:

>d3ukua1 c.55.1.1 (A:2-160) Actin-related protein 3, Arp3 {Cow (Bos taurus) [TaxId: 9913]}
agrlpacvvdcgtgytklgyagntepqfiipsciaikesakvgdqaqrrvmkgvddldff
igdeaiekptyatkwpirhgivedwdlmerfmeqvifkylraepedhyflltepplntpe
nreytaeimfesfnvpglyiavqavlalaaswtsrqvge

Sequence, based on observed residues (ATOM records):

>d3ukua1 c.55.1.1 (A:2-160) Actin-related protein 3, Arp3 {Cow (Bos taurus) [TaxId: 9913]}
agrlpacvvdcgtgytklgyagntepqfiipsciaikemkgvddldffigdeaiekptya
tkwpirhgivedwdlmerfmeqvifkylraepedhyflltepplntpenreytaeimfes
fnvpglyiavqavlalaaswtsrqvge

Timeline for d3ukua1:

• d3ukua1 is new in SCOPe 2.03-stable
  
• d3ukua1 appears in SCOPe 2.04
  
• d3ukua1 appears in the current release, SCOPe 2.08