Lineage for d3ukub_ (3uku B:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1372364Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1372365Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families) (S)
    duplication contains two domains of this fold
  5. 1372366Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 1372539Protein Actin-related protein 2, Arp2 [69530] (1 species)
    part of Arp2/3 complex
  7. 1372540Species Cow (Bos taurus) [TaxId:9913] [69531] (14 PDB entries)
    Uniprot P61160 143-350 # 100% sequence identity
  8. 1372553Domain d3ukub_: 3uku B: [201000]
    Other proteins in same PDB: d3ukua1, d3ukua2, d3ukuc_, d3ukud1, d3ukud2, d3ukue_, d3ukuf_, d3ukug_
    automated match to d1u2vb1
    complexed with c69

Details for d3ukub_

PDB Entry: 3uku (more details), 2.75 Å

PDB Description: Structure of Arp2/3 complex with bound inhibitor CK-869
PDB Compounds: (B:) actin-like protein 2

SCOPe Domain Sequences for d3ukub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ukub_ c.55.1.1 (B:) Actin-related protein 2, Arp2 {Cow (Bos taurus) [TaxId: 9913]}
gvvvdsgdgvthicpvyegfslphltrrldiagrditrylikllllrgyafnhsadfetv
rmikeklcyvgynieqeqklalettvlvesytlpdgriikvggerfeapealfqphlinv
egvgvaellfntiqaadidtrsefykhivlsggstmypglpsrlerelkqlylervlkgd
veklskfkiriedpp

SCOPe Domain Coordinates for d3ukub_:

Click to download the PDB-style file with coordinates for d3ukub_.
(The format of our PDB-style files is described here.)

Timeline for d3ukub_: