Lineage for d3ukue_ (3uku E:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1284322Fold a.148: Arp2/3 complex 21 kDa subunit ARPC3 [69059] (1 superfamily)
    5 helices; one helix is surrounded by the others
  4. 1284323Superfamily a.148.1: Arp2/3 complex 21 kDa subunit ARPC3 [69060] (1 family) (S)
    automatically mapped to Pfam PF04062
  5. 1284324Family a.148.1.1: Arp2/3 complex 21 kDa subunit ARPC3 [69061] (2 proteins)
  6. 1284332Protein automated matches [190347] (1 species)
    not a true protein
  7. 1284333Species Cow (Bos taurus) [TaxId:9913] [187174] (11 PDB entries)
  8. 1284343Domain d3ukue_: 3uku E: [193252]
    Other proteins in same PDB: d3ukua1, d3ukua2, d3ukub_, d3ukuc_, d3ukud1, d3ukud2, d3ukuf_, d3ukug_
    automated match to d1k8ke_
    complexed with c69

Details for d3ukue_

PDB Entry: 3uku (more details), 2.75 Å

PDB Description: Structure of Arp2/3 complex with bound inhibitor CK-869
PDB Compounds: (E:) Actin-related protein 2/3 complex subunit 3

SCOPe Domain Sequences for d3ukue_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ukue_ a.148.1.1 (E:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
payhsslmdpdtklignmallpirsqfkgpapretkdtdivdeaiyyfkanvffknyeik
neadrtliyitlyiseclkklqkcnsksqgekemytlgitnfpipgepgfplnaiyakpa
nkqedevmraylqqlrqetglrlcekvfdpqndkpskwwtcfvkrqfmnksls

SCOPe Domain Coordinates for d3ukue_:

Click to download the PDB-style file with coordinates for d3ukue_.
(The format of our PDB-style files is described here.)

Timeline for d3ukue_: