SCOPe 2.06: Domain d3ujma1: 3ujm A:15-130

Lineage for d3ujma1 (3ujm A:15-130)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.0: automated matches [191337] (1 protein)
   not a true family

6. Protein automated matches [190205] (26 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [195496] (1 PDB entry)

8. Domain d3ujma1: 3ujm A:15-130 [200990]
   Other proteins in same PDB: d3ujma2, d3ujmb2
   automated match to d3ujmb_
   complexed with epe

Details for d3ujma1

PDB Entry: 3ujm, 2.74 Å

PDB Description: crystal structure of the ntf2-like domain of the drosophila melanogaster rasputin protein

PDB Compounds: (A:) Rasputin

SCOPe Domain Sequences for d3ujma1:

Sequence; same for both SEQRES and ATOM records:

>d3ujma1 d.17.4.0 (A:15-130) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
svgrefvrqyytllnkapnhlhrfynhnssyihgesklvvgqreihnriqqlnfndchak
isqvdaqatlgngvvvqvtgelsndgqpmrrftqtfvlaaqspkkyyvhndifryq

Timeline for d3ujma1:

• d3ujma1 first appeared in SCOPe 2.03, called d3ujma_
  
• d3ujma1 was called d3ujma_ in SCOPe 2.05
  
• d3ujma1 appears in SCOPe 2.07
  
• d3ujma1 appears in the current release, SCOPe 2.08