SCOPe 2.05: Domain d3ujma_: 3ujm A:

Lineage for d3ujma_ (3ujm A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.0: automated matches [191337] (1 protein)
   not a true family

6. Protein automated matches [190205] (21 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [195496] (1 PDB entry)

8. Domain d3ujma_: 3ujm A: [200990]
   automated match to d3ujmb_
   complexed with epe

Details for d3ujma_

PDB Entry: 3ujm, 2.74 Å

PDB Description: crystal structure of the ntf2-like domain of the drosophila melanogaster rasputin protein

PDB Compounds: (A:) Rasputin

SCOPe Domain Sequences for d3ujma_:

Sequence; same for both SEQRES and ATOM records:

>d3ujma_ d.17.4.0 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
msvgrefvrqyytllnkapnhlhrfynhnssyihgesklvvgqreihnriqqlnfndcha
kisqvdaqatlgngvvvqvtgelsndgqpmrrftqtfvlaaqspkkyyvhndifryq

Timeline for d3ujma_:

• d3ujma_ first appeared in SCOPe 2.03
  
• d3ujma_ appears in SCOPe 2.04
  
• d3ujma_ is called d3ujma1 in SCOPe 2.06
  
• d3ujma_ appears in the current release, SCOPe 2.08, called d3ujma1