| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
| Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins) |
| Protein Ferric-binding protein FbpA [53867] (7 species) |
| Species Neisseria gonorrhoeae [TaxId:485] [53869] (5 PDB entries) Uniprot Q50964 23-331 |
| Domain d3tyhd_: 3tyh D: [200896] automated match to d1xc1a_ complexed with cu |
PDB Entry: 3tyh (more details), 2.1 Å
SCOPe Domain Sequences for d3tyhd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tyhd_ c.94.1.1 (D:) Ferric-binding protein FbpA {Neisseria gonorrhoeae [TaxId: 485]}
ditvyngqhkeaaqavadaftratgikvklnsakgdqlagqikeegsrspadvfyseqip
alatlsaanlleplpastinetrgkgvpvaakkdwvalsgrsrvvvydtrklsekdleks
vlnyatpkwknrigyvptsgafleqivaivklkgeaaalkwlkglkeygkpyaknsvalq
avengeidaalinnyywhafarekgvqnvhtrlnfvrhrdpgalvtysgaavlkssqnkd
eakkfvaflagkegqraltavraeyplnphvvstfnlepiakleapqvsattvsekehat
rlleqagmk
Timeline for d3tyhd_: