Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) |
Family c.66.1.24: rRNA adenine dimethylase-like [88784] (5 proteins) |
Protein automated matches [190861] (2 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [196023] (1 PDB entry) |
Domain d3tpza_: 3tpz A: [200855] automated match to d3tpzb_ complexed with cl, po4; mutant |
PDB Entry: 3tpz (more details), 2.1 Å
SCOPe Domain Sequences for d3tpza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tpza_ c.66.1.24 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]} fgqnflndqfvidsivsainpqkgqamveigpglaaltepvgerldqltvieldrdlaar lqthpflgpkltiyqqdamtfnfgelaekmgqplrvfgnppynistplmfhlfsytdaia dmhfmlqkevvnrlvagpnskaygrlsvmaqyycnvipvlevppsaftpppkvdsavvrl vphatmphpvkdvrvlsritteafnqrrktirnslgnlfsvevltgmgidpamraenisv aqycqmanylaen
Timeline for d3tpza_: