SCOPe 2.08: Domain d3tpza_: 3tpz A:

Lineage for d3tpza_ (3tpz A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families)

5. Family c.66.1.24: rRNA adenine dimethylase-like [88784] (5 proteins)

6. Protein automated matches [190861] (2 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [196023] (1 PDB entry)

8. Domain d3tpza_: 3tpz A: [200855]
   automated match to d3tpzb_
   complexed with cl, po4; mutant

Details for d3tpza_

PDB Entry: 3tpz, 2.1 Å

PDB Description: 2.1 Angstrom crystal structure of the L114P mutant of E. Coli KsgA

PDB Compounds: (A:) Ribosomal RNA small subunit methyltransferase A

SCOPe Domain Sequences for d3tpza_:

Sequence; same for both SEQRES and ATOM records:

>d3tpza_ c.66.1.24 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
fgqnflndqfvidsivsainpqkgqamveigpglaaltepvgerldqltvieldrdlaar
lqthpflgpkltiyqqdamtfnfgelaekmgqplrvfgnppynistplmfhlfsytdaia
dmhfmlqkevvnrlvagpnskaygrlsvmaqyycnvipvlevppsaftpppkvdsavvrl
vphatmphpvkdvrvlsritteafnqrrktirnslgnlfsvevltgmgidpamraenisv
aqycqmanylaen

Timeline for d3tpza_:

• d3tpza_ first appeared in SCOPe 2.03
  
• d3tpza_ appears in SCOPe 2.07