Lineage for d3tpza_ (3tpz A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1378488Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 1378489Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) (S)
  5. 1379033Family c.66.1.24: rRNA adenine dimethylase-like [88784] (5 proteins)
  6. 1379054Protein automated matches [190861] (2 species)
    not a true protein
  7. 1379055Species Escherichia coli [TaxId:83333] [196023] (1 PDB entry)
  8. 1379056Domain d3tpza_: 3tpz A: [200855]
    automated match to d3tpzb_
    complexed with cl, po4; mutant

Details for d3tpza_

PDB Entry: 3tpz (more details), 2.1 Å

PDB Description: 2.1 Angstrom crystal structure of the L114P mutant of E. Coli KsgA
PDB Compounds: (A:) Ribosomal RNA small subunit methyltransferase A

SCOPe Domain Sequences for d3tpza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tpza_ c.66.1.24 (A:) automated matches {Escherichia coli [TaxId: 83333]}
fgqnflndqfvidsivsainpqkgqamveigpglaaltepvgerldqltvieldrdlaar
lqthpflgpkltiyqqdamtfnfgelaekmgqplrvfgnppynistplmfhlfsytdaia
dmhfmlqkevvnrlvagpnskaygrlsvmaqyycnvipvlevppsaftpppkvdsavvrl
vphatmphpvkdvrvlsritteafnqrrktirnslgnlfsvevltgmgidpamraenisv
aqycqmanylaen

SCOPe Domain Coordinates for d3tpza_:

Click to download the PDB-style file with coordinates for d3tpza_.
(The format of our PDB-style files is described here.)

Timeline for d3tpza_: