Lineage for d3tioa_ (3tio A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2813832Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2813833Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 2814180Family b.81.1.0: automated matches [191560] (1 protein)
    not a true family
  6. 2814181Protein automated matches [190967] (36 species)
    not a true protein
  7. 2814263Species Escherichia coli K-12 [TaxId:83333] [193604] (2 PDB entries)
  8. 2814264Domain d3tioa_: 3tio A: [200826]
    automated match to d3tioc_
    complexed with po4, zn

Details for d3tioa_

PDB Entry: 3tio (more details), 1.41 Å

PDB Description: Crystal structures of yrdA from Escherichia coli, a homologous protein of gamma-class carbonic anhydrase, show possible allosteric conformations
PDB Compounds: (A:) Protein YrdA

SCOPe Domain Sequences for d3tioa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tioa_ b.81.1.0 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
dvlhpyrdlfpqigqrvmiddssvvigdvrladdvgiwplvvirgdvhyvqigartniqd
gsmlhvthkssynpdgnpltigedvtvghkvmlhgctignrvlvgmgsilldgaiveddv
migagslvpqnkrlesgylylgspvkqirplsdeekaglrysannyvkwkdeyldq

SCOPe Domain Coordinates for d3tioa_:

Click to download the PDB-style file with coordinates for d3tioa_.
(The format of our PDB-style files is described here.)

Timeline for d3tioa_: