Lineage for d3tioe_ (3tio E:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2403213Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2403214Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 2403509Family b.81.1.0: automated matches [191560] (1 protein)
    not a true family
  6. 2403510Protein automated matches [190967] (31 species)
    not a true protein
  7. 2403584Species Escherichia coli K-12 [TaxId:83333] [193604] (2 PDB entries)
  8. 2403589Domain d3tioe_: 3tio E: [200829]
    automated match to d3tioc_
    complexed with po4, zn

Details for d3tioe_

PDB Entry: 3tio (more details), 1.41 Å

PDB Description: Crystal structures of yrdA from Escherichia coli, a homologous protein of gamma-class carbonic anhydrase, show possible allosteric conformations
PDB Compounds: (E:) Protein YrdA

SCOPe Domain Sequences for d3tioe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tioe_ b.81.1.0 (E:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
dvlhpyrdlfpqigqrvmiddssvvigdvrladdvgiwplvvirgdvhyvqigartniqd
gsmlhvthkssynpdgnpltigedvtvghkvmlhgctignrvlvgmgsilldgaiveddv
migagslvpqnkrlesgylylgspvkqirplsdeekaglrysannyvkwkdeyldq

SCOPe Domain Coordinates for d3tioe_:

Click to download the PDB-style file with coordinates for d3tioe_.
(The format of our PDB-style files is described here.)

Timeline for d3tioe_: