PDB entry 3tio

View 3tio on RCSB PDB site
Description: Crystal structures of yrdA from Escherichia coli, a homologous protein of gamma-class carbonic anhydrase, show possible allosteric conformations
Class: transferase
Keywords: Carbonic anhydrase (CA) catalyzes, zinc ion binding, TRANSFERASE
Deposited on 2011-08-21, released 2012-08-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-08-29, with a file datestamp of 2012-08-24.
Experiment type: XRAY
Resolution: 1.41 Å
R-factor: 0.193
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein YrdA
    Species: Escherichia coli [TaxId:83333]
    Gene: yrdA, b3279, JW5710
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A9W9
      • engineered mutation (4)
    Domains in SCOPe 2.07: d3tioa_
  • Chain 'B':
    Compound: Protein YrdA
    Species: Escherichia coli [TaxId:83333]
    Gene: yrdA, b3279, JW5710
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A9W9
      • engineered mutation (4)
    Domains in SCOPe 2.07: d3tiob_
  • Chain 'C':
    Compound: Protein YrdA
    Species: Escherichia coli [TaxId:83333]
    Gene: yrdA, b3279, JW5710
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A9W9
      • engineered mutation (4)
    Domains in SCOPe 2.07: d3tioc_
  • Chain 'D':
    Compound: Protein YrdA
    Species: Escherichia coli [TaxId:83333]
    Gene: yrdA, b3279, JW5710
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A9W9
      • engineered mutation (4)
    Domains in SCOPe 2.07: d3tiod_
  • Chain 'E':
    Compound: Protein YrdA
    Species: Escherichia coli [TaxId:83333]
    Gene: yrdA, b3279, JW5710
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A9W9
      • engineered mutation (4)
    Domains in SCOPe 2.07: d3tioe_
  • Chain 'F':
    Compound: Protein YrdA
    Species: Escherichia coli [TaxId:83333]
    Gene: yrdA, b3279, JW5710
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A9W9
      • engineered mutation (4)
    Domains in SCOPe 2.07: d3tiof_
  • Heterogens: ZN, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3tioA (A:)
    sdvlhpyrdlfpqigqrvmiddssvvigdvrladdvgiwplvvirgdvhyvqigartniq
    dgsmlhvthkssynpdgnpltigedvtvghkvmlhgctignrvlvgmgsilldgaivedd
    vmigagslvpqnkrlesgylylgspvkqirplsdeekaglrysannyvkwkdeyldqgnq
    tqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tioA (A:)
    dvlhpyrdlfpqigqrvmiddssvvigdvrladdvgiwplvvirgdvhyvqigartniqd
    gsmlhvthkssynpdgnpltigedvtvghkvmlhgctignrvlvgmgsilldgaiveddv
    migagslvpqnkrlesgylylgspvkqirplsdeekaglrysannyvkwkdeyldq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3tioB (B:)
    sdvlhpyrdlfpqigqrvmiddssvvigdvrladdvgiwplvvirgdvhyvqigartniq
    dgsmlhvthkssynpdgnpltigedvtvghkvmlhgctignrvlvgmgsilldgaivedd
    vmigagslvpqnkrlesgylylgspvkqirplsdeekaglrysannyvkwkdeyldqgnq
    tqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tioB (B:)
    dvlhpyrdlfpqigqrvmiddssvvigdvrladdvgiwplvvirgdvhyvqigartniqd
    gsmlhvthksnpltigedvtvghkvmlhgctignrvlvgmgsilldgaiveddvmigags
    lvpqnkrlesgylylgspvkqirplsdeekaglrysannyvkwkdeyldq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3tioC (C:)
    sdvlhpyrdlfpqigqrvmiddssvvigdvrladdvgiwplvvirgdvhyvqigartniq
    dgsmlhvthkssynpdgnpltigedvtvghkvmlhgctignrvlvgmgsilldgaivedd
    vmigagslvpqnkrlesgylylgspvkqirplsdeekaglrysannyvkwkdeyldqgnq
    tqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tioC (C:)
    dvlhpyrdlfpqigqrvmiddssvvigdvrladdvgiwplvvirgdvhyvqigartniqd
    gsmlhvthkssynpdgnpltigedvtvghkvmlhgctignrvlvgmgsilldgaiveddv
    migagslvpqnkrlesgylylgspvkqirplsdeekaglrysannyvkwkdeyldq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3tioD (D:)
    sdvlhpyrdlfpqigqrvmiddssvvigdvrladdvgiwplvvirgdvhyvqigartniq
    dgsmlhvthkssynpdgnpltigedvtvghkvmlhgctignrvlvgmgsilldgaivedd
    vmigagslvpqnkrlesgylylgspvkqirplsdeekaglrysannyvkwkdeyldqgnq
    tqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tioD (D:)
    dvlhpyrdlfpqigqrvmiddssvvigdvrladdvgiwplvvirgdvhyvqigartniqd
    gsmlhvthkssynpdgnpltigedvtvghkvmlhgctignrvlvgmgsilldgaiveddv
    migagslvpqnkrlesgylylgspvkqirplsdeekaglrysannyvkwkdeyl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3tioE (E:)
    sdvlhpyrdlfpqigqrvmiddssvvigdvrladdvgiwplvvirgdvhyvqigartniq
    dgsmlhvthkssynpdgnpltigedvtvghkvmlhgctignrvlvgmgsilldgaivedd
    vmigagslvpqnkrlesgylylgspvkqirplsdeekaglrysannyvkwkdeyldqgnq
    tqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tioE (E:)
    dvlhpyrdlfpqigqrvmiddssvvigdvrladdvgiwplvvirgdvhyvqigartniqd
    gsmlhvthkssynpdgnpltigedvtvghkvmlhgctignrvlvgmgsilldgaiveddv
    migagslvpqnkrlesgylylgspvkqirplsdeekaglrysannyvkwkdeyldq
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3tioF (F:)
    sdvlhpyrdlfpqigqrvmiddssvvigdvrladdvgiwplvvirgdvhyvqigartniq
    dgsmlhvthkssynpdgnpltigedvtvghkvmlhgctignrvlvgmgsilldgaivedd
    vmigagslvpqnkrlesgylylgspvkqirplsdeekaglrysannyvkwkdeyldqgnq
    tqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tioF (F:)
    dvlhpyrdlfpqigqrvmiddssvvigdvrladdvgiwplvvirgdvhyvqigartniqd
    gsmlhvthkssynpdgnpltigedvtvghkvmlhgctignrvlvgmgsilldgaiveddv
    migagslvpqnkrlesgylylgspvkqirplsdeekaglrysannyvkwkdeyldqg