Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.0: automated matches [227140] (1 protein) not a true family |
Protein automated matches [226842] (5 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [224924] (70 PDB entries) |
Domain d3sdaa1: 3sda A:6-185 [200614] Other proteins in same PDB: d3sdaa2, d3sdaa3, d3sdab_, d3sdac1, d3sdac2, d3sdad1, d3sdad2 automated match to d1gzpa2 complexed with gcy, gol, nag |
PDB Entry: 3sda (more details), 2.8 Å
SCOPe Domain Sequences for d3sdaa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sdaa1 d.19.1.0 (A:6-185) automated matches {Mouse (Mus musculus) [TaxId: 10090]} knytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqwek lqhmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemypgnasesflhvafqgkyv vrfwgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek
Timeline for d3sdaa1: