Lineage for d3sdaa1 (3sda A:6-185)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2544619Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2544620Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2545715Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 2545716Protein automated matches [226842] (5 species)
    not a true protein
  7. 2545946Species Mouse (Mus musculus) [TaxId:10090] [224924] (70 PDB entries)
  8. 2546023Domain d3sdaa1: 3sda A:6-185 [200614]
    Other proteins in same PDB: d3sdaa2, d3sdaa3, d3sdab_, d3sdac1, d3sdac2, d3sdad1, d3sdad2
    automated match to d1gzpa2
    complexed with gcy, gol, nag

Details for d3sdaa1

PDB Entry: 3sda (more details), 2.8 Å

PDB Description: crystal structure of autoreactive-valpha14-vbeta6 nkt tcr in complex with cd1d-beta-galactosylceramide
PDB Compounds: (A:) Antigen-presenting glycoprotein CD1d1

SCOPe Domain Sequences for d3sdaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sdaa1 d.19.1.0 (A:6-185) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
knytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqwek
lqhmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemypgnasesflhvafqgkyv
vrfwgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek

SCOPe Domain Coordinates for d3sdaa1:

Click to download the PDB-style file with coordinates for d3sdaa1.
(The format of our PDB-style files is described here.)

Timeline for d3sdaa1: