Lineage for d3sdac2 (3sda C:118-204)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2020524Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2024392Protein automated matches [190374] (14 species)
    not a true protein
  7. 2025381Species Mouse (Mus musculus) [TaxId:10090] [224855] (494 PDB entries)
  8. 2025940Domain d3sdac2: 3sda C:118-204 [200617]
    Other proteins in same PDB: d3sdaa1, d3sdaa3, d3sdab_, d3sdac1, d3sdad1
    automated match to d1qrnd2
    complexed with gcy, gol, nag

Details for d3sdac2

PDB Entry: 3sda (more details), 2.8 Å

PDB Description: crystal structure of autoreactive-valpha14-vbeta6 nkt tcr in complex with cd1d-beta-galactosylceramide
PDB Compounds: (C:) NKT TCR Valpha14 chain

SCOPe Domain Sequences for d3sdac2:

Sequence, based on SEQRES records: (download)

>d3sdac2 b.1.1.2 (C:118-204) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtff

Sequence, based on observed residues (ATOM records): (download)

>d3sdac2 b.1.1.2 (C:118-204) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsacanafnnsiipedtff

SCOPe Domain Coordinates for d3sdac2:

Click to download the PDB-style file with coordinates for d3sdac2.
(The format of our PDB-style files is described here.)

Timeline for d3sdac2: