Lineage for d3ryid1 (3ryi D:1-245)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2863166Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2863167Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 2863168Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)
  6. 2863308Protein automated matches [226837] (9 species)
    not a true protein
  7. 2864059Species Sheep (Ovis aries) [TaxId:9940] [224884] (15 PDB entries)
  8. 2864071Domain d3ryid1: 3ryi D:1-245 [200567]
    Other proteins in same PDB: d3ryia2, d3ryib2, d3ryic2, d3ryid2, d3ryie1, d3ryie2
    automated match to d1z2bb1
    complexed with gdp, gtp, mg, so4

Details for d3ryid1

PDB Entry: 3ryi (more details), 2.4 Å

PDB Description: GDP-Tubulin: rb3 stathmin-like domain complex
PDB Compounds: (D:) Tubulin beta chain

SCOPe Domain Sequences for d3ryid1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ryid1 c.32.1.1 (D:1-245) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyv
prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv
rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvv
epynatlsvhqlventdetysidnealydicfrtlklttptygdlnhlvsatmsgvttcl
rfp

SCOPe Domain Coordinates for d3ryid1:

Click to download the PDB-style file with coordinates for d3ryid1.
(The format of our PDB-style files is described here.)

Timeline for d3ryid1: