Lineage for d3ryib1 (3ryi B:1-245)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2107739Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2107740Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 2107741Family c.32.1.1: Tubulin, GTPase domain [52491] (4 protein domains)
  6. 2107851Protein automated matches [226837] (7 species)
    not a true protein
  7. 2107925Species Sheep (Ovis aries) [TaxId:9940] [224884] (13 PDB entries)
  8. 2107935Domain d3ryib1: 3ryi B:1-245 [200563]
    Other proteins in same PDB: d3ryia2, d3ryib2, d3ryic2, d3ryid2, d3ryie1, d3ryie2
    automated match to d1z2bb1
    complexed with gdp, gtp, mg, so4

Details for d3ryib1

PDB Entry: 3ryi (more details), 2.4 Å

PDB Description: GDP-Tubulin: rb3 stathmin-like domain complex
PDB Compounds: (B:) Tubulin beta chain

SCOPe Domain Sequences for d3ryib1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ryib1 c.32.1.1 (B:1-245) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyv
prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv
rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvv
epynatlsvhqlventdetysidnealydicfrtlklttptygdlnhlvsatmsgvttcl
rfp

SCOPe Domain Coordinates for d3ryib1:

Click to download the PDB-style file with coordinates for d3ryib1.
(The format of our PDB-style files is described here.)

Timeline for d3ryib1: