![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
![]() | Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) ![]() |
![]() | Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) |
![]() | Protein automated matches [227071] (7 species) not a true protein |
![]() | Species Sheep (Ovis aries) [TaxId:9940] [226224] (15 PDB entries) |
![]() | Domain d3ryic2: 3ryi C:246-438 [200566] Other proteins in same PDB: d3ryia1, d3ryib1, d3ryic1, d3ryid1, d3ryie1, d3ryie2 automated match to d1z2ba2 complexed with gdp, gtp, mg, so4 |
PDB Entry: 3ryi (more details), 2.4 Å
SCOPe Domain Sequences for d3ryic2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ryic2 d.79.2.1 (C:246-438) automated matches {Sheep (Ovis aries) [TaxId: 9940]} galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm aalekdyeevgvd
Timeline for d3ryic2: