Lineage for d3ryfd2 (3ryf D:246-441)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2525085Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2525406Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2525407Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 2525526Protein automated matches [227071] (5 species)
    not a true protein
  7. 2525736Species Sheep (Ovis aries) [TaxId:9940] [226224] (15 PDB entries)
  8. 2525754Domain d3ryfd2: 3ryf D:246-441 [200552]
    Other proteins in same PDB: d3ryfa1, d3ryfb1, d3ryfc1, d3ryfd1, d3ryfe1, d3ryfe2
    automated match to d1z2bb2
    complexed with gtp, mg, so4

Details for d3ryfd2

PDB Entry: 3ryf (more details), 2.52 Å

PDB Description: GTP-Tubulin: RB3 Stathmin-like domain complex
PDB Compounds: (D:) Tubulin beta chain

SCOPe Domain Sequences for d3ryfd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ryfd2 d.79.2.1 (D:246-441) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac
dprhgryltvatifrgrmsmkevdeqmlniqnknssyfvewipnnvktavcdipprglkm
sstfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqdatad

SCOPe Domain Coordinates for d3ryfd2:

Click to download the PDB-style file with coordinates for d3ryfd2.
(The format of our PDB-style files is described here.)

Timeline for d3ryfd2: