![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
![]() | Superfamily a.137.10: Stathmin [101494] (1 family) ![]() single long helix crosslinking four tubulin subunits automatically mapped to Pfam PF00836 |
![]() | Family a.137.10.1: Stathmin [101495] (2 proteins) |
![]() | Protein Stathmin 4 [101496] (3 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (186 PDB entries) |
![]() | Domain d3ryfe1: 3ryf E:5-145 [185205] Other proteins in same PDB: d3ryfa1, d3ryfa2, d3ryfb1, d3ryfb2, d3ryfc1, d3ryfc2, d3ryfd1, d3ryfd2, d3ryfe2 automated match to d1sa0e_ complexed with gtp, mg, so4 |
PDB Entry: 3ryf (more details), 2.52 Å
SCOPe Domain Sequences for d3ryfe1:
Sequence, based on SEQRES records: (download)
>d3ryfe1 a.137.10.1 (E:5-145) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]} dmevielnkatsgqswevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyq eaellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlq ekdkhaeevrknkelkeeasr
>d3ryfe1 a.137.10.1 (E:5-145) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]} dmevielnkatsgqswevilkppsfdgvperrrdpsleeiqkkleaaeerrkyqeaellk hlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkha eevrknkelkeeasr
Timeline for d3ryfe1: