SCOPe 2.08: Domain d3rtqc2: 3rtq C:118-206

Lineage for d3rtqc2 (3rtq C:118-206)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein T-cell antigen receptor [49125] (7 species)
Species Mouse (Mus musculus) [TaxId:10090] [226194] (2 PDB entries)
Domain d3rtqc2: 3rtq C:118-206 [200519]
Other proteins in same PDB: d3rtqa1, d3rtqa2, d3rtqb_, d3rtqc1, d3rtqd1, d3rtqd2
automated match to d1qrnd2
complexed with h4s, nag

Details for d3rtqc2

PDB Entry: 3rtq (more details), 2.8 Å

PDB Description: structure of the mouse cd1d-hs44-inkt tcr complex

PDB Compounds: (C:) Valpha14 (mouse variable domain, human constant domain)

SCOPe Domain Sequences for d3rtqc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rtqc2 b.1.1.2 (C:118-206) T-cell antigen receptor {Mouse (Mus musculus) [TaxId: 10090]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

SCOPe Domain Coordinates for d3rtqc2:

Click to download the PDB-style file with coordinates for d3rtqc2.
(The format of our PDB-style files is described here.)

Timeline for d3rtqc2: