Lineage for d3rtqc2 (3rtq C:118-206)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1290587Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1294107Protein T-cell antigen receptor [49125] (7 species)
  7. 1294198Species Mouse (Mus musculus) [TaxId:10090] [226194] (2 PDB entries)
  8. 1294199Domain d3rtqc2: 3rtq C:118-206 [200519]
    Other proteins in same PDB: d3rtqa1, d3rtqa2, d3rtqb_, d3rtqc1, d3rtqd1, d3rtqd2
    automated match to d1qrnd2
    complexed with h4s, nag

Details for d3rtqc2

PDB Entry: 3rtq (more details), 2.8 Å

PDB Description: structure of the mouse cd1d-hs44-inkt tcr complex
PDB Compounds: (C:) Valpha14 (mouse variable domain, human constant domain)

SCOPe Domain Sequences for d3rtqc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rtqc2 b.1.1.2 (C:118-206) T-cell antigen receptor {Mouse (Mus musculus) [TaxId: 10090]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

SCOPe Domain Coordinates for d3rtqc2:

Click to download the PDB-style file with coordinates for d3rtqc2.
(The format of our PDB-style files is described here.)

Timeline for d3rtqc2: