Lineage for d3rtqd2 (3rtq D:113-240)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2760475Domain d3rtqd2: 3rtq D:113-240 [200521]
    Other proteins in same PDB: d3rtqa1, d3rtqa2, d3rtqb_, d3rtqc2, d3rtqd1
    automated match to d1lp9f2
    complexed with h4s, nag

Details for d3rtqd2

PDB Entry: 3rtq (more details), 2.8 Å

PDB Description: structure of the mouse cd1d-hs44-inkt tcr complex
PDB Compounds: (D:) V beta8.2 (mouse variable domain, human constant domain)

SCOPe Domain Sequences for d3rtqd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rtqd2 b.1.1.0 (D:113-240) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dlrnvtppkvslfepskaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryslssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgra

SCOPe Domain Coordinates for d3rtqd2:

Click to download the PDB-style file with coordinates for d3rtqd2.
(The format of our PDB-style files is described here.)

Timeline for d3rtqd2: