SCOPe 2.06: Domain d3rsed1: 3rse D:1-120

Lineage for d3rsed1 (3rse D:1-120)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.198: Secretion chaperone-like [69634] (5 superfamilies)
   alpha-beta(3)-alpha-beta(2)-alpha; 2 layers: alpha/beta

4. Superfamily d.198.2: Arp2/3 complex subunits [69645] (1 family)

5. Family d.198.2.1: Arp2/3 complex subunits [69646] (3 proteins)

6. Protein ARPC2 (34 kDa subunit) [69649] (1 species)
   duplication: tandem repeat of two domains of this fold

7. Species Cow (Bos taurus) [TaxId:9913] [69650] (16 PDB entries)
   Uniprot O15144 1-282 # 100% sequence identity

8. Domain d3rsed1: 3rse D:1-120 [200510]
   Other proteins in same PDB: d3rsea1, d3rsea2, d3rseb_, d3rsec_, d3rsee_, d3rsef_, d3rseg_
   automated match to d1k8kd1

Details for d3rsed1

PDB Entry: 3rse, 2.65 Å

PDB Description: Structural and biochemical characterization of two binding sites for nucleation promoting factor WASp-VCA on Arp2/3 complex

PDB Compounds: (D:) Actin-related protein 2/3 complex subunit 2

SCOPe Domain Sequences for d3rsed1:

Sequence; same for both SEQRES and ATOM records:

>d3rsed1 d.198.2.1 (D:1-120) ARPC2 (34 kDa subunit) {Cow (Bos taurus) [TaxId: 9913]}
millevnnriieetlalkfenaaagnkpeavevtfadfdgvlyhisnpngdktkvmvsis
lkfykelqahgadellkrvygsylvnpesgynvsllydlenlpaskdsivhqagmlkrnc

Timeline for d3rsed1:

• d3rsed1 first appeared in SCOPe 2.03
  
• d3rsed1 appears in SCOPe 2.05
  
• d3rsed1 appears in SCOPe 2.07
  
• d3rsed1 appears in the current release, SCOPe 2.08