SCOPe 2.06: Domain d3rsef_: 3rse F:

Lineage for d3rsef_ (3rse F:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.198: Secretion chaperone-like [69634] (5 superfamilies)
   alpha-beta(3)-alpha-beta(2)-alpha; 2 layers: alpha/beta

4. Superfamily d.198.2: Arp2/3 complex subunits [69645] (1 family)

5. Family d.198.2.1: Arp2/3 complex subunits [69646] (3 proteins)

6. Protein ARPC4 (20 kDa subunit) [69647] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [69648] (17 PDB entries)
   Uniprot P59998 # 100% sequence identity

8. Domain d3rsef_: 3rse F: [185144]
   Other proteins in same PDB: d3rsea1, d3rsea2, d3rseb_, d3rsec_, d3rsed1, d3rsed2, d3rsee_, d3rseg_
   automated match to d1k8kf_

Details for d3rsef_

PDB Entry: 3rse, 2.65 Å

PDB Description: Structural and biochemical characterization of two binding sites for nucleation promoting factor WASp-VCA on Arp2/3 complex

PDB Compounds: (F:) Actin-related protein 2/3 complex subunit 4

SCOPe Domain Sequences for d3rsef_:

Sequence; same for both SEQRES and ATOM records:

>d3rsef_ d.198.2.1 (F:) ARPC4 (20 kDa subunit) {Cow (Bos taurus) [TaxId: 9913]}
tatlrpylsavratlqaalclenfssqvverhnkpevevrsskelllqpvtisrnekekv
liegsinsvrvsiavkqadeiekilchkfmrfmmmraenffilrrkpvegydisflitnf
hteqmykhklvdfvihfmeeidkeisemklsvnararivaeeflknf

Timeline for d3rsef_:

• d3rsef_ first appeared in SCOPe 2.01
  
• d3rsef_ appears in SCOPe 2.05
  
• d3rsef_ appears in SCOPe 2.07
  
• d3rsef_ appears in the current release, SCOPe 2.08