Lineage for d3rsea1 (3rse A:2-160)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1605035Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1605036Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 1605037Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 1605250Protein Actin-related protein 3, Arp3 [69528] (1 species)
    part of Arp2/3 complex
  7. 1605251Species Cow (Bos taurus) [TaxId:9913] [69529] (16 PDB entries)
    Uniprot P61158
  8. 1605282Domain d3rsea1: 3rse A:2-160 [200507]
    Other proteins in same PDB: d3rseb_, d3rsec_, d3rsed1, d3rsed2, d3rsee_, d3rsef_, d3rseg_
    automated match to d1u2va1

Details for d3rsea1

PDB Entry: 3rse (more details), 2.65 Å

PDB Description: Structural and biochemical characterization of two binding sites for nucleation promoting factor WASp-VCA on Arp2/3 complex
PDB Compounds: (A:) Actin-related protein 3

SCOPe Domain Sequences for d3rsea1:

Sequence, based on SEQRES records: (download)

>d3rsea1 c.55.1.1 (A:2-160) Actin-related protein 3, Arp3 {Cow (Bos taurus) [TaxId: 9913]}
agrlpacvvdcgtgytklgyagntepqfiipsciaikesakvgdqaqrrvmkgvddldff
igdeaiekptyatkwpirhgivedwdlmerfmeqvifkylraepedhyflltepplntpe
nreytaeimfesfnvpglyiavqavlalaaswtsrqvge

Sequence, based on observed residues (ATOM records): (download)

>d3rsea1 c.55.1.1 (A:2-160) Actin-related protein 3, Arp3 {Cow (Bos taurus) [TaxId: 9913]}
agrlpacvvdcgtgytklgyagntepqfiipsciaikkgvddldffigdeaiekptyatk
wpirhgivedwdlmerfmeqvifkylraepedhyflltepplntpenreytaeimfesfn
vpglyiavqavlalaaswtsrqvge

SCOPe Domain Coordinates for d3rsea1:

Click to download the PDB-style file with coordinates for d3rsea1.
(The format of our PDB-style files is described here.)

Timeline for d3rsea1: